SCOPe 2.06: Domain d1aogb3: 1aog B:358-487

Lineage for d1aogb3 (1aog B:358-487)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Trypanothione reductase [55429] (3 species)

7. Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)

8. Domain d1aogb3: 1aog B:358-487 [40191]
   Other proteins in same PDB: d1aoga1, d1aoga2, d1aogb1, d1aogb2
   complexed with fad, mae

Details for d1aogb3

PDB Entry: 1aog, 2.3 Å

PDB Description: trypanosoma cruzi trypanothione reductase (oxidized form)

PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1aogb3:

Sequence; same for both SEQRES and ATOM records:

>d1aogb3 d.87.1.1 (B:358-487) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
dhtrvasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiit
nhsdgtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyy
yvkgekmekp

Timeline for d1aogb3:

• d1aogb3 first appeared (with stable ids) in SCOP 1.55
  
• d1aogb3 appears in SCOPe 2.05
  
• d1aogb3 appears in SCOPe 2.07
  
• d1aogb3 appears in the current release, SCOPe 2.08