Lineage for d1feab3 (1fea B:358-484)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962968Protein Trypanothione reductase [55429] (3 species)
  7. 2962969Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 2962975Domain d1feab3: 1fea B:358-484 [40181]
    Other proteins in same PDB: d1feaa1, d1feaa2, d1feab1, d1feab2, d1feac1, d1feac2, d1fead1, d1fead2
    complexed with fad

Details for d1feab3

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1feab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feab3 d.87.1.1 (B:358-484) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrve

SCOPe Domain Coordinates for d1feab3:

Click to download the PDB-style file with coordinates for d1feab3.
(The format of our PDB-style files is described here.)

Timeline for d1feab3: