Lineage for d4gr1a3 (4gr1 A:364-478)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204290Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2204291Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2204331Protein Glutathione reductase [55426] (3 species)
  7. 2204341Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)
  8. 2204359Domain d4gr1a3: 4gr1 A:364-478 [40162]
    Other proteins in same PDB: d4gr1a1, d4gr1a2
    complexed with fad, po4, rgs

Details for d4gr1a3

PDB Entry: 4gr1 (more details), 2.4 Å

PDB Description: the binding of the retro-analogue of glutathione disulfide to glutathione reductase
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d4gr1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gr1a3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOPe Domain Coordinates for d4gr1a3:

Click to download the PDB-style file with coordinates for d4gr1a3.
(The format of our PDB-style files is described here.)

Timeline for d4gr1a3: