SCOPe 2.06: Domain d1bwca3: 1bwc A:364-478

Lineage for d1bwca3 (1bwc A:364-478)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Glutathione reductase [55426] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)

8. Domain d1bwca3: 1bwc A:364-478 [40161]
   Other proteins in same PDB: d1bwca1, d1bwca2
   complexed with aj3, cl, fad

Details for d1bwca3

PDB Entry: 1bwc, 2.1 Å

PDB Description: structure of human glutathione reductase complexed with ajoene inhibitor and subversive substrate

PDB Compounds: (A:) protein (glutathione reductase)

SCOPe Domain Sequences for d1bwca3:

Sequence; same for both SEQRES and ATOM records:

>d1bwca3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

Timeline for d1bwca3:

• d1bwca3 first appeared (with stable ids) in SCOP 1.55
  
• d1bwca3 appears in SCOPe 2.05
  
• d1bwca3 appears in SCOPe 2.07
  
• d1bwca3 appears in the current release, SCOPe 2.08