Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (7 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [401398] (2 PDB entries) |
Domain d6z5rc_: 6z5r C: [401486] Other proteins in same PDB: d6z5rh1, d6z5rh2, d6z5rl_, d6z5rm_ automated match to d1xrda1 complexed with 6pl, bcl, bph, cdl, crt, fe, fme, lmt, pgt, qak, u10 |
PDB Entry: 6z5r (more details), 2.8 Å
SCOPe Domain Sequences for d6z5rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z5rc_ f.3.1.0 (C:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} mwriwllfdprralvllfvflfglaiiihfillstsrfnwldgpra
Timeline for d6z5rc_:
View in 3D Domains from other chains: (mouse over for more information) d6z5r0_, d6z5r1_, d6z5r2_, d6z5r3_, d6z5r4_, d6z5r5_, d6z5r6_, d6z5r7_, d6z5r8_, d6z5r9_, d6z5ra_, d6z5rb_, d6z5rd_, d6z5re_, d6z5rf_, d6z5rg_, d6z5rh1, d6z5rh2, d6z5ri_, d6z5rj_, d6z5rk_, d6z5rl_, d6z5rm_, d6z5rn_, d6z5ro_, d6z5rp_, d6z5rq_, d6z5rr_, d6z5rs_, d6z5rt_, d6z5ru_, d6z5rv_, d6z5rx_, d6z5ry_, d6z5rz_ |