Lineage for d6z5r7_ (6z5r 7:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627145Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 2627146Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 2627209Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 2627210Protein automated matches [254444] (7 species)
    not a true protein
  7. 2627245Species Rhodopseudomonas palustris [TaxId:258594] [401398] (2 PDB entries)
  8. 2627281Domain d6z5r7_: 6z5r 7: [401451]
    Other proteins in same PDB: d6z5rh1, d6z5rh2, d6z5rl_, d6z5rm_
    automated match to d1xrda1
    complexed with 6pl, bcl, bph, cdl, crt, fe, fme, lmt, pgt, qak, u10

Details for d6z5r7_

PDB Entry: 6z5r (more details), 2.8 Å

PDB Description: rc-lh1(16) complex from rhodopseudomonas palustris
PDB Compounds: (7:) Light-harvesting complex 1 alpha chain

SCOPe Domain Sequences for d6z5r7_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z5r7_ f.3.1.0 (7:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mwriwllfdprralvllfvflfglaiiihfillstsrfnwldgpra

SCOPe Domain Coordinates for d6z5r7_:

Click to download the PDB-style file with coordinates for d6z5r7_.
(The format of our PDB-style files is described here.)

Timeline for d6z5r7_: