Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries) |
Domain d6y08b_: 6y08 B: [401284] automated match to d4eb4a_ complexed with 08d, ump |
PDB Entry: 6y08 (more details), 2.3 Å
SCOPe Domain Sequences for d6y08b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y08b_ d.117.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleel lwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaeykd mdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvngel scqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplkiq lqreprpfpklkilrkvetiddfkvedfqiegynphpt
Timeline for d6y08b_: