![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Quinol oxidase (CyoA) [49542] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49543] (4 PDB entries) |
![]() | Domain d6wtib2: 6wti B:118-285 [400921] Other proteins in same PDB: d6wtib1 automated match to d1fftb1 complexed with 3pe, cu, hem, heo, u9v, uq8 |
PDB Entry: 6wti (more details), 2.38 Å
SCOPe Domain Sequences for d6wtib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wtib2 b.6.1.2 (B:118-285) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfmahg
Timeline for d6wtib2: