Lineage for d1fftb1 (1fft B:118-283)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) 
Protein Quinol oxidase (CyoA) [49542] (1 species) Species Escherichia coli [TaxId:562] [49543] (4 PDB entries) 
Domain d1fftb1: 1fft B:118-283 [23025]
Other proteins in same PDB: d1ffta_, d1fftb2, d1fftc2, d1fftc3, d1fftf_, d1fftg2, d1ffth2, d1ffth3
complexed with cu, hem, heo
Details for d1fftb1
PDB Entry: 1fft (more details), 3.5 Å
PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (B:) ubiquinol oxidaseSCOPe Domain Sequences for d1fftb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fftb1 b.6.1.2 (B:118-283) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma
SCOPe Domain Coordinates for d1fftb1:
Click to download the PDB-style file with coordinates for d1fftb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fftb1:
View in 3D
