Lineage for d1ffth2 (1fft H:25-203)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632473Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2632474Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 2632475Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2632484Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)
  7. 2632485Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)
  8. 2632487Domain d1ffth2: 1fft H:25-203 [43632]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftc3, d1fftf_, d1fftg1, d1fftg2, d1ffth3
    complexed with cu, hem, heo

Details for d1ffth2

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (H:) ubiquinol oxidase

SCOPe Domain Sequences for d1ffth2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffth2 f.25.1.1 (H:25-203) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
kifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllfssityg
maaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsaffalvg
thglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvvylmga

SCOPe Domain Coordinates for d1ffth2:

Click to download the PDB-style file with coordinates for d1ffth2.
(The format of our PDB-style files is described here.)

Timeline for d1ffth2: