Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) Pfam PF10634 |
Family b.1.33.0: automated matches [310673] (1 protein) not a true family |
Protein automated matches [310872] (2 species) not a true protein |
Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries) |
Domain d6wefc_: 6wef C: [400887] Other proteins in same PDB: d6wefb2, d6wefd2, d6wefh2, d6wefj2, d6wefl2 automated match to d3lzlb_ complexed with cu, gol, so4 |
PDB Entry: 6wef (more details), 2.5 Å
SCOPe Domain Sequences for d6wefc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wefc_ b.1.33.0 (C:) automated matches {Campylobacter jejuni [TaxId: 354242]} gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf wmpyltiayelkntdtgaikrgtlmpmvadhgphyganiamekdkkggfgvgnyeltfyi snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk
Timeline for d6wefc_: