Lineage for d6wefg_ (6wef G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376924Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2376942Family b.1.33.0: automated matches [310673] (1 protein)
    not a true family
  6. 2376943Protein automated matches [310872] (2 species)
    not a true protein
  7. 2376944Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries)
  8. 2376975Domain d6wefg_: 6wef G: [400876]
    Other proteins in same PDB: d6wefb2, d6wefd2, d6wefh2, d6wefj2, d6wefl2
    automated match to d3lzlb_
    complexed with cu, gol, so4

Details for d6wefg_

PDB Entry: 6wef (more details), 2.5 Å

PDB Description: copper-bound d92h variant of campylobacter jejuni p19
PDB Compounds: (G:) Uncharacterized protein

SCOPe Domain Sequences for d6wefg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wefg_ b.1.33.0 (G:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvadhgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

SCOPe Domain Coordinates for d6wefg_:

Click to download the PDB-style file with coordinates for d6wefg_.
(The format of our PDB-style files is described here.)

Timeline for d6wefg_: