Lineage for d7nqza2 (7nqz A:219-418)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493223Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)
  8. 2493266Domain d7nqza2: 7nqz A:219-418 [400081]
    automated match to d3fe1a2
    complexed with an2, cl, gol, pg4, po4, wm7

Details for d7nqza2

PDB Entry: 7nqz (more details), 2.32 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain in complex with z1827898537
PDB Compounds: (A:) Heat shock protein 70

SCOPe Domain Sequences for d7nqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nqza2 c.55.1.0 (A:219-418) automated matches {Plasmodium falciparum [TaxId: 36329]}
gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk
nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm
dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde
avaygaavqaailsgdqssa

SCOPe Domain Coordinates for d7nqza2:

Click to download the PDB-style file with coordinates for d7nqza2.
(The format of our PDB-style files is described here.)

Timeline for d7nqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7nqza1