Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
Domain d7nqrb2: 7nqr B:219-414 [400072] automated match to d3fe1a2 complexed with an2, cl, gol, pg6, po4, syq |
PDB Entry: 7nqr (more details), 2.22 Å
SCOPe Domain Sequences for d7nqrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nqrb2 c.55.1.0 (B:219-414) automated matches {Plasmodium falciparum [TaxId: 36329]} gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde avaygaavqaailsgd
Timeline for d7nqrb2: