SCOPe 2.07: Domain d6m0qa_: 6m0q A:

Lineage for d6m0qa_ (6m0q A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (12 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:915] [256367] (4 PDB entries)

8. Domain d6m0qa_: 6m0q A: [399953]
   automated match to d4n4na_
   complexed with hec, isw, peg, pg4, pge

Details for d6m0qa_

PDB Entry: 6m0q, 1.99 Å

PDB Description: hydroxylamine oxidoreductase from nitrosomonas europaea

PDB Compounds: (A:) Aerobic hydroxylamine oxidoreductase

SCOPe Domain Sequences for d6m0qa_:

Sequence; same for both SEQRES and ATOM records:

>d6m0qa_ a.138.1.3 (A:) automated matches {Nitrosomonas europaea [TaxId: 915]}
distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
iqdeytkmqelsalqarvnklegk

Timeline for d6m0qa_:

• d6m0qa_ is new in SCOPe 2.07-stable
  
• d6m0qa_ appears in the current release, SCOPe 2.08