Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein automated matches [190276] (12 species) not a true protein |
Species Nitrosomonas europaea [TaxId:915] [256367] (4 PDB entries) |
Domain d6m0qi_: 6m0q I: [399930] automated match to d4n4na_ complexed with hec, isw, peg, pg4, pge |
PDB Entry: 6m0q (more details), 1.99 Å
SCOPe Domain Sequences for d6m0qi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m0qi_ a.138.1.3 (I:) automated matches {Nitrosomonas europaea [TaxId: 915]} distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve iqdeytkmqelsalqarvnklegk
Timeline for d6m0qi_: