SCOPe 2.07: Domain d6lukq1: 6luk Q:459-526

Lineage for d6lukq1 (6luk Q:459-526)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d6lukq1: 6luk Q:459-526 [399945]
   Other proteins in same PDB: d6luka2, d6lukb2, d6lukc2, d6lukd2, d6luke2, d6lukf2, d6lukg2, d6lukh2, d6luki2, d6lukj2, d6lukk2, d6lukl2, d6lukm2, d6lukn2, d6luko2, d6lukp2, d6lukq2, d6lukr2, d6luks2, d6lukt2
   automated match to d1pk1d_
   complexed with so4

Details for d6lukq1

PDB Entry: 6luk, 2.05 Å

PDB Description: crystal structure of the samd1 sam domain in another crystal form

PDB Compounds: (Q:) Atherin

SCOPe Domain Sequences for d6lukq1:

Sequence; same for both SEQRES and ATOM records:

>d6lukq1 a.60.1.0 (Q:459-526) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvewtvmdvveyfteagfpeqatafqeqeidgkslllmqrtdvltglsirlgpalkiyeh
hikvlqqg

Timeline for d6lukq1:

• d6lukq1 is new in SCOPe 2.07-stable
  
• d6lukq1 appears in the current release, SCOPe 2.08