Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
Protein automated matches [190031] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries) |
Domain d6lukq1: 6luk Q:459-526 [399945] Other proteins in same PDB: d6luka2, d6lukb2, d6lukc2, d6lukd2, d6luke2, d6lukf2, d6lukg2, d6lukh2, d6luki2, d6lukj2, d6lukk2, d6lukl2, d6lukm2, d6lukn2, d6luko2, d6lukp2, d6lukq2, d6lukr2, d6luks2, d6lukt2 automated match to d1pk1d_ complexed with so4 |
PDB Entry: 6luk (more details), 2.05 Å
SCOPe Domain Sequences for d6lukq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lukq1 a.60.1.0 (Q:459-526) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvewtvmdvveyfteagfpeqatafqeqeidgkslllmqrtdvltglsirlgpalkiyeh hikvlqqg
Timeline for d6lukq1:
View in 3D Domains from other chains: (mouse over for more information) d6luka1, d6luka2, d6lukb1, d6lukb2, d6lukc1, d6lukc2, d6lukd1, d6lukd2, d6luke1, d6luke2, d6lukf1, d6lukf2, d6lukg1, d6lukg2, d6lukh1, d6lukh2, d6luki1, d6luki2, d6lukj1, d6lukj2, d6lukk1, d6lukk2, d6lukl1, d6lukl2, d6lukm1, d6lukm2, d6lukn1, d6lukn2, d6luko1, d6luko2, d6lukp1, d6lukp2, d6lukr1, d6lukr2, d6luks1, d6luks2, d6lukt1, d6lukt2 |