Lineage for d1dapa2 (1dap A:119-268)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135178Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (3 proteins)
  6. 135184Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
  7. 135185Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)
  8. 135191Domain d1dapa2: 1dap A:119-268 [39968]
    Other proteins in same PDB: d1dapa1, d1dapb1

Details for d1dapa2

PDB Entry: 1dap (more details), 2.2 Å

PDB Description: c. glutamicum dap dehydrogenase in complex with nadp+

SCOP Domain Sequences for d1dapa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dapa2 d.81.1.3 (A:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

SCOP Domain Coordinates for d1dapa2:

Click to download the PDB-style file with coordinates for d1dapa2.
(The format of our PDB-style files is described here.)

Timeline for d1dapa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dapa1