Lineage for d6lerb_ (6ler B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698556Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)
  8. 2698631Domain d6lerb_: 6ler B: [399608]
    Other proteins in same PDB: d6lerc_, d6lerd_, d6lerg_, d6lerh_, d6lerm_, d6lern_, d6lerq_, d6lerr_
    automated match to d1kx5b_
    protein/DNA complex; complexed with ca, k

Details for d6lerb_

PDB Entry: 6ler (more details), 3 Å

PDB Description: 169 bp nucleosome harboring non-identical cohesive dna termini.
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d6lerb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lerb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d6lerb_:

Click to download the PDB-style file with coordinates for d6lerb_.
(The format of our PDB-style files is described here.)

Timeline for d6lerb_: