Lineage for d6l9zg_ (6l9z G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698159Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (5 PDB entries)
    Uniprot P28001 11-118
  8. 2698169Domain d6l9zg_: 6l9z G: [399511]
    Other proteins in same PDB: d6l9za_, d6l9zb_, d6l9zd_, d6l9ze_, d6l9zf_, d6l9zh_, d6l9zk_, d6l9zl_, d6l9zn_, d6l9zo_, d6l9zp_, d6l9zr_, d6l9zs_
    automated match to d2cv5c1
    protein/DNA complex; complexed with ca, cl, k

Details for d6l9zg_

PDB Entry: 6l9z (more details), 2.5 Å

PDB Description: 338 bp di-nucleosome assembled with linker histone h1.x
PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d6l9zg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9zg_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]}
kaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpkk

SCOPe Domain Coordinates for d6l9zg_:

Click to download the PDB-style file with coordinates for d6l9zg_.
(The format of our PDB-style files is described here.)

Timeline for d6l9zg_: