SCOPe 2.07: Domain d7ju2b_: 7ju2 B:

Lineage for d7ju2b_ (7ju2 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein automated matches [254583] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [399101] (1 PDB entry)

8. Domain d7ju2b_: 7ju2 B: [399102]
   automated match to d2qara_
   complexed with fmt

Details for d7ju2b_

PDB Entry: 7ju2, 1.85 Å

PDB Description: crystal structure of the monomeric etv6 pnt domain

PDB Compounds: (B:) transcription factor etv6

SCOPe Domain Sequences for d7ju2b_:

Sequence; same for both SEQRES and ATOM records:

>d7ju2b_ a.60.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
phsgdelyellqhilkq

Timeline for d7ju2b_:

• d7ju2b_ is new in SCOPe 2.07-stable
  
• d7ju2b_ appears in the current release, SCOPe 2.08