Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Succinate dehydrogenase subunit SdhD [82872] (1 species) membrane anchor protein |
Species Escherichia coli [TaxId:562] [82873] (7 PDB entries) |
Domain d7jz2l_: 7jz2 L: [399099] Other proteins in same PDB: d7jz2a1, d7jz2a2, d7jz2b1, d7jz2b2, d7jz2c_, d7jz2e1, d7jz2e2, d7jz2f1, d7jz2f2, d7jz2g_, d7jz2i1, d7jz2i2, d7jz2j1, d7jz2j2, d7jz2k_ automated match to d1nekd_ complexed with 3pe, f3s, fad, fes, hem, na, sf4, uq2 |
PDB Entry: 7jz2 (more details), 2.5 Å
SCOPe Domain Sequences for d7jz2l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jz2l_ f.21.2.2 (L:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} snasalgrngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftl lalfsilihawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv
Timeline for d7jz2l_: