Lineage for d7jz2l_ (7jz2 L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630134Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
    membrane anchor protein
  7. 2630135Species Escherichia coli [TaxId:562] [82873] (7 PDB entries)
  8. 2630147Domain d7jz2l_: 7jz2 L: [399099]
    Other proteins in same PDB: d7jz2a1, d7jz2a2, d7jz2b1, d7jz2b2, d7jz2c_, d7jz2e1, d7jz2e2, d7jz2f1, d7jz2f2, d7jz2g_, d7jz2i1, d7jz2i2, d7jz2j1, d7jz2j2, d7jz2k_
    automated match to d1nekd_
    complexed with 3pe, f3s, fad, fes, hem, na, sf4, uq2

Details for d7jz2l_

PDB Entry: 7jz2 (more details), 2.5 Å

PDB Description: succinate: quinone oxidoreductase sqr from e.coli k12
PDB Compounds: (L:) succinate dehydrogenase hydrophobic membrane anchor subunit

SCOPe Domain Sequences for d7jz2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jz2l_ f.21.2.2 (L:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
snasalgrngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftl
lalfsilihawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

SCOPe Domain Coordinates for d7jz2l_:

Click to download the PDB-style file with coordinates for d7jz2l_.
(The format of our PDB-style files is described here.)

Timeline for d7jz2l_: