Lineage for d7jz2i2 (7jz2 I:451-588)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309960Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2309961Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2310000Protein Succinate dehydogenase [81708] (3 species)
  7. 2310001Species Escherichia coli [TaxId:562] [81709] (7 PDB entries)
  8. 2310016Domain d7jz2i2: 7jz2 I:451-588 [399028]
    Other proteins in same PDB: d7jz2a1, d7jz2b1, d7jz2b2, d7jz2c_, d7jz2d_, d7jz2e1, d7jz2f1, d7jz2f2, d7jz2g_, d7jz2h_, d7jz2i1, d7jz2j1, d7jz2j2, d7jz2k_, d7jz2l_
    automated match to d1neka1
    complexed with 3pe, f3s, fad, fes, hem, na, sf4, uq2

Details for d7jz2i2

PDB Entry: 7jz2 (more details), 2.5 Å

PDB Description: succinate: quinone oxidoreductase sqr from e.coli k12
PDB Compounds: (I:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d7jz2i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jz2i2 a.7.3.1 (I:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

SCOPe Domain Coordinates for d7jz2i2:

Click to download the PDB-style file with coordinates for d7jz2i2.
(The format of our PDB-style files is described here.)

Timeline for d7jz2i2: