Lineage for d7dsac_ (7dsa C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain d1ixva1
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006650Domain d7dsac_: 7dsa C: [398891]
    Other proteins in same PDB: d7dsaa_, d7dsab_
    automated match to d2kxpc_
    complexed with mg

Details for d7dsac_

PDB Entry: 7dsa (more details), 2.8 Å

PDB Description: crystal structure of actin capping protein in complex with v-1 (space group p62)
PDB Compounds: (C:) myotrophin

SCOPe Domain Sequences for d7dsac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dsac_ d.211.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgadi
napdkhhitpllsavyeghvscvklllskgadktvkgpdgltafeatdnqaikallq

SCOPe Domain Coordinates for d7dsac_:

Click to download the PDB-style file with coordinates for d7dsac_.
(The format of our PDB-style files is described here.)

Timeline for d7dsac_: