SCOPe 2.08: Domain d7dcla_: 7dcl A:

Lineage for d7dcla_ (7dcl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (15 PDB entries)

8. Domain d7dcla_: 7dcl A: [398833]
   automated match to d5xzja_
   complexed with cl, hec, zn

Details for d7dcla_

PDB Entry: 7dcl, 2.45 Å

PDB Description: crystal structure of the zn-directed tetramer of the engineered cyt cb 562 variant, c96i/a38s ab5

PDB Compounds: (A:) engineered cyt cb 562 variant, AB5

SCOPe Domain Sequences for d7dcla_:

Sequence; same for both SEQRES and ATOM records:

>d7dcla_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaasdawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkdaqeaaehlkitcnhchqkyr

Timeline for d7dcla_:

• d7dcla_ first appeared in SCOPe 2.07