SCOPe 2.08: Domain d7bskb1: 7bsk B:23-279

Lineage for d7bskb1 (7bsk B:23-279)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225016] (9 PDB entries)

8. Domain d7bskb1: 7bsk B:23-279 [398549]
   Other proteins in same PDB: d7bska2, d7bskb2
   automated match to d3wjaa1
   complexed with nad; mutant

Details for d7bskb1

PDB Entry: 7bsk, 2.55 Å

PDB Description: crystal structure of human me2 r67q mutant

PDB Compounds: (B:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d7bskb1:

Sequence; same for both SEQRES and ATOM records:

>d7bskb1 c.58.1.0 (B:23-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalqfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

Timeline for d7bskb1:

• d7bskb1 first appeared in SCOPe 2.07