Lineage for d7bsla2 (7bsl A:280-565)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847190Domain d7bsla2: 7bsl A:280-565 [398548]
    Other proteins in same PDB: d7bsla1, d7bslb1
    automated match to d3wjaa2
    complexed with nad; mutant

Details for d7bsla2

PDB Entry: 7bsl (more details), 2.55 Å

PDB Description: crystal structure of human me2 r67a mutant
PDB Compounds: (A:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d7bsla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bsla2 c.2.1.0 (A:280-565) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsl

SCOPe Domain Coordinates for d7bsla2:

Click to download the PDB-style file with coordinates for d7bsla2.
(The format of our PDB-style files is described here.)

Timeline for d7bsla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7bsla1