Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d7bsla2: 7bsl A:280-565 [398548] Other proteins in same PDB: d7bsla1, d7bslb1 automated match to d3wjaa2 complexed with nad; mutant |
PDB Entry: 7bsl (more details), 2.55 Å
SCOPe Domain Sequences for d7bsla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bsla2 c.2.1.0 (A:280-565) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani qevsiniaikvteylyankmafrypepedkakyvkertwrseydsl
Timeline for d7bsla2: