Lineage for d7bsja2 (7bsj A:280-572)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455436Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries)
  8. 2455592Domain d7bsja2: 7bsj A:280-572 [398524]
    Other proteins in same PDB: d7bsja1, d7bsjb1
    automated match to d3wjaa2
    complexed with fum, mg, nad, ttn

Details for d7bsja2

PDB Entry: 7bsj (more details), 2.48 Å

PDB Description: crystal structure of human me2 r484w
PDB Compounds: (A:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d7bsja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bsja2 c.2.1.0 (A:280-572) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntwhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyew

SCOPe Domain Coordinates for d7bsja2:

Click to download the PDB-style file with coordinates for d7bsja2.
(The format of our PDB-style files is described here.)

Timeline for d7bsja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7bsja1