SCOPe 2.08: Domain d7aaab2: 7aaa B:797-1011

Lineage for d7aaab2 (7aaa B:797-1011)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)

8. Domain d7aaab2: 7aaa B:797-1011 [398220]
   Other proteins in same PDB: d7aaaa1, d7aaab1
   automated match to d4hhyd2
   complexed with dms, edo, so4

Details for d7aaab2

PDB Entry: 7aaa, 1.74 Å

PDB Description: crystal structure of the catalytic domain of human parp1 (apo)

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7aaab2:

Sequence; same for both SEQRES and ATOM records:

>d7aaab2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d7aaab2:

• d7aaab2 first appeared in SCOPe 2.07