Lineage for d1ck8b_ (1ck8 B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies) 
Superfamily d.79.3: L30e-like [55315] (2 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) 
Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (7 PDB entries) 
Domain d1ck8b_: 1ck8 B: [39811]
Details for d1ck8b_
PDB Entry: 1ck8 (more details)
PDB Description: rpl30-mrna complex from yeast
SCOP Domain Sequences for d1ck8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ck8b_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae)}
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla
SCOP Domain Coordinates for d1ck8b_:
Click to download the PDB-style file with coordinates for d1ck8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ck8b_:
- d1ck8b_ first appeared (with stable ids) in SCOP 1.55
- d1ck8b_ appears in SCOP 1.59
- d1ck8b_ last appears in SCOP 1.71
View in 3D