Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein automated matches [191209] (6 species) not a true protein |
Species Mucor circinelloides [TaxId:36080] [397778] (2 PDB entries) |
Domain d6vrxc_: 6vrx C: [397801] automated match to d3uqia_ complexed with fk5 |
PDB Entry: 6vrx (more details), 2.54 Å
SCOPe Domain Sequences for d6vrxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vrxc_ d.26.1.1 (C:) automated matches {Mucor circinelloides [TaxId: 36080]} mgvtveriapgdgknfpkkgdkvtihyvgtlengdkfdssrdrgspfqctigvgqvikgw degvtqlsvgekarlicthdyaygergypglippkatlnfevelikin
Timeline for d6vrxc_: