Lineage for d6vrxa_ (6vrx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548640Protein automated matches [191209] (6 species)
    not a true protein
  7. 2548719Species Mucor circinelloides [TaxId:36080] [397778] (2 PDB entries)
  8. 2548721Domain d6vrxa_: 6vrx A: [397797]
    automated match to d3uqia_
    complexed with fk5

Details for d6vrxa_

PDB Entry: 6vrx (more details), 2.54 Å

PDB Description: mucor circinelloides fkbp12 protein bound with fk506 in p3221 space group
PDB Compounds: (A:) peptidylprolyl isomerase

SCOPe Domain Sequences for d6vrxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vrxa_ d.26.1.1 (A:) automated matches {Mucor circinelloides [TaxId: 36080]}
mgvtveriapgdgknfpkkgdkvtihyvgtlengdkfdssrdrgspfqctigvgqvikgw
degvtqlsvgekarlicthdyaygergypglippkatlnfevelikin

SCOPe Domain Coordinates for d6vrxa_:

Click to download the PDB-style file with coordinates for d6vrxa_.
(The format of our PDB-style files is described here.)

Timeline for d6vrxa_: