Class a: All alpha proteins [46456] (284 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (1 protein) |
Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
Species Human (Homo sapiens) [TaxId:9606] [55296] (1 PDB entry) |
Domain d1qkla_: 1qkl A: [39754] |
PDB Entry: 1qkl (more details)
SCOPe Domain Sequences for d1qkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} msdnednfdgddfddveedeglddlenaeeegqenveilpsgerpqanqkrittpymtky erarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirrylpdgsyedwgv deliitd
Timeline for d1qkla_: