Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (13 species) not a true protein |
Species Lolium rigidum [TaxId:89674] [396705] (1 PDB entry) |
Domain d6zb6a2: 6zb6 A:85-219 [396708] Other proteins in same PDB: d6zb6a1, d6zb6a3, d6zb6b1, d6zb6c1, d6zb6c3, d6zb6d1, d6zb6e1, d6zb6f1 automated match to d1axda1 complexed with gol, gsh, gtb, na |
PDB Entry: 6zb6 (more details), 1.9 Å
SCOPe Domain Sequences for d6zb6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zb6a2 a.45.1.1 (A:85-219) automated matches {Lolium rigidum [TaxId: 89674]} dllregnlkeaamvdvwtevdahtynpalspivyqclfnpmmrgiptdekvvaesleklk kvlevyearlsqheylagdfvsfadlnhfpytfyfmatphaalfgsyphvkawwerimar paikkisatmvppka
Timeline for d6zb6a2: