Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein automated matches [227019] (4 species) not a true protein |
Species Lolium rigidum [TaxId:89674] [396703] (1 PDB entry) |
Domain d6zb6a1: 6zb6 A:1-84 [396707] Other proteins in same PDB: d6zb6a2, d6zb6a3, d6zb6b2, d6zb6c2, d6zb6c3, d6zb6d2, d6zb6e2, d6zb6f2 automated match to d1axda2 complexed with gol, gsh, gtb, na |
PDB Entry: 6zb6 (more details), 1.9 Å
SCOPe Domain Sequences for d6zb6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zb6a1 c.47.1.5 (A:1-84) automated matches {Lolium rigidum [TaxId: 89674]} mapvkvfgpamstnvarvlvfleevgadyevvdmdfkvmehkspehlarnpfgqipafqd gdlllfesraiskyvlrkyktgev
Timeline for d6zb6a1: