Lineage for d6z86e_ (6z86 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966181Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2966342Protein automated matches [195794] (2 species)
    not a true protein
  7. 2966343Species Human (Homo sapiens) [TaxId:9606] [396510] (9 PDB entries)
  8. 2966348Domain d6z86e_: 6z86 E: [396595]
    automated match to d1fb1a_
    complexed with qbq, zn

Details for d6z86e_

PDB Entry: 6z86 (more details), 2.21 Å

PDB Description: human gtp cyclohydrolase i in complex with 7-deaza-gtp
PDB Compounds: (E:) GTP cyclohydrolase 1

SCOPe Domain Sequences for d6z86e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z86e_ d.96.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetisdvln
daifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklariveiysrr
lqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvfredp
ktreefltli

SCOPe Domain Coordinates for d6z86e_:

Click to download the PDB-style file with coordinates for d6z86e_.
(The format of our PDB-style files is described here.)

Timeline for d6z86e_: