SCOPe 2.07: Domain d6x3jb_: 6x3j B:

Lineage for d6x3jb_ (6x3j B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein automated matches [190704] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193357] (6 PDB entries)

8. Domain d6x3jb_: 6x3j B: [396256]
   automated match to d4husc_
   complexed with cl, mg, o7v, po4, sxa

Details for d6x3jb_

PDB Entry: 6x3j, 2.7 Å

PDB Description: crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46)

PDB Compounds: (B:) Virginiamycin A acetyltransferase,VatA

SCOPe Domain Sequences for d6x3jb_:

Sequence; same for both SEQRES and ATOM records:

>d6x3jb_ b.81.1.3 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
wnldmkiinenlpfiingdiemlkrk

Timeline for d6x3jb_:

• d6x3jb_ is new in SCOPe 2.07-stable
  
• d6x3jb_ appears in the current release, SCOPe 2.08