Lineage for d6x3ce_ (6x3c E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423339Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 2423406Protein automated matches [190704] (6 species)
    not a true protein
  7. 2423420Species Staphylococcus aureus [TaxId:1280] [193357] (6 PDB entries)
  8. 2423443Domain d6x3ce_: 6x3c E: [396241]
    automated match to d4e8la_
    complexed with cl, mg, o7s, po4, so4, sxa

Details for d6x3ce_

PDB Entry: 6x3c (more details), 3.05 Å

PDB Description: crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47)
PDB Compounds: (E:) Virginiamycin A acetyltransferase

SCOPe Domain Sequences for d6x3ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x3ce_ b.81.1.3 (E:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
wnldmkiinenlpfiingdieml

SCOPe Domain Coordinates for d6x3ce_:

Click to download the PDB-style file with coordinates for d6x3ce_.
(The format of our PDB-style files is described here.)

Timeline for d6x3ce_: