Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (15 species) not a true protein |
Species Escherichia coli [TaxId:83333] [376807] (5 PDB entries) |
Domain d6wrfn_: 6wrf N: [396188] Other proteins in same PDB: d6wrfa_, d6wrfb_, d6wrfc_, d6wrfd_, d6wrfe_, d6wrff_, d6wrfm2 automated match to d1tg6e_ complexed with adp, ags, mg |
PDB Entry: 6wrf (more details), 3.14 Å
SCOPe Domain Sequences for d6wrfn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wrfn_ c.14.1.1 (N:) automated matches {Escherichia coli [TaxId: 83333]} lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave yglvdsilthr
Timeline for d6wrfn_: