SCOPe 2.07: Domain d6wr2h_: 6wr2 H:

Lineage for d6wr2h_ (6wr2 H:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
   automatically mapped to Pfam PF00574

6. Protein automated matches [190149] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [376807] (5 PDB entries)

8. Domain d6wr2h_: 6wr2 H: [396166]
   Other proteins in same PDB: d6wr2k2, d6wr2n2
   automated match to d1tg6e_

Details for d6wr2h_

PDB Entry: 6wr2, 2.88 Å

PDB Description: clpp and clpx igf loop in clpx-clpp complex bound to ssra tagged gfp

PDB Compounds: (H:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6wr2h_:

Sequence; same for both SEQRES and ATOM records:

>d6wr2h_ c.14.1.1 (H:) automated matches {Escherichia coli [TaxId: 83333]}
lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
yglvdsilthrn

Timeline for d6wr2h_:

• d6wr2h_ is new in SCOPe 2.07-stable
  
• d6wr2h_ appears in the current release, SCOPe 2.08