Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (15 species) not a true protein |
Species Neisseria meningitidis [TaxId:487] [376758] (5 PDB entries) |
Domain d6w9tc_: 6w9t C: [396068] automated match to d5g1sl_ complexed with k, khs |
PDB Entry: 6w9t (more details), 1.64 Å
SCOPe Domain Sequences for d6w9tc_:
Sequence, based on SEQRES records: (download)
>d6w9tc_ c.14.1.1 (C:) automated matches {Neisseria meningitidis [TaxId: 487]} vptvieqsgrgerafdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffy inspggsvtagmsiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimih qplisgglggqasdieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeak eyglidqilenrasl
>d6w9tc_ c.14.1.1 (C:) automated matches {Neisseria meningitidis [TaxId: 487]} vptvdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffyinspggsvtag msiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimihqplisgqasdi eiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeakeyglidqilenrasl
Timeline for d6w9tc_: