Lineage for d5s71a2 (5s71 A:191-346)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615811Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 2615812Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 2615821Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
    PfamB PB001946
  6. 2615838Protein automated matches [384919] (1 species)
    not a true protein
  7. 2615839Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384920] (27 PDB entries)
  8. 2615844Domain d5s71a2: 5s71 A:191-346 [395631]
    Other proteins in same PDB: d5s71a1, d5s71a3, d5s71b1, d5s71b3
    automated match to d2h85a2
    complexed with cit, wuv

Details for d5s71a2

PDB Entry: 5s71 (more details), 1.94 Å

PDB Description: pandda analysis group deposition -- crystal structure of sars-cov-2 nendou in complex with fuzs-5
PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d5s71a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s71a2 d.294.1.2 (A:191-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypklq

SCOPe Domain Coordinates for d5s71a2:

Click to download the PDB-style file with coordinates for d5s71a2.
(The format of our PDB-style files is described here.)

Timeline for d5s71a2: