Lineage for d6lcaa_ (6lca A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395913Domain d6lcaa_: 6lca A: [395253]
    automated match to d3fy5a_
    complexed with so4

Details for d6lcaa_

PDB Entry: 6lca (more details), 2.4 Å

PDB Description: crystal structure of human dishevelled1 pdz domain homotrimer
PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d6lcaa_:

Sequence, based on SEQRES records: (download)

>d6lcaa_ b.36.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
nivtvtlnmerhhflgisivgqsndrgdggiyigsimkggavaadgriepgdmllqvndv
nfenmsnddavrvlreivsqtgpisltvaka

Sequence, based on observed residues (ATOM records): (download)

>d6lcaa_ b.36.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
nivtvtlnmerhhflgisivgqsdgiyigsimkggavaadgriepgdmllqvndvnfenm
snddavrvlreivsqtgpisltvaka

SCOPe Domain Coordinates for d6lcaa_:

Click to download the PDB-style file with coordinates for d6lcaa_.
(The format of our PDB-style files is described here.)

Timeline for d6lcaa_: