Lineage for d6lcab_ (6lca B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395914Domain d6lcab_: 6lca B: [395252]
    automated match to d3fy5a_
    complexed with so4

Details for d6lcab_

PDB Entry: 6lca (more details), 2.4 Å

PDB Description: crystal structure of human dishevelled1 pdz domain homotrimer
PDB Compounds: (B:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d6lcab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lcab_ b.36.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]}
nivtvtlnmerhhflgisivgqsndrgdggiyigsimkggavaadgriepgdmllqvndv
nfenmsnddavrvlreivsqtgpisltvak

SCOPe Domain Coordinates for d6lcab_:

Click to download the PDB-style file with coordinates for d6lcab_.
(The format of our PDB-style files is described here.)

Timeline for d6lcab_: