![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein automated matches [195197] (6 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:243277] [390552] (2 PDB entries) |
![]() | Domain d6lh7a_: 6lh7 A: [395165] automated match to d4fo7b_ complexed with gol, na, ni |
PDB Entry: 6lh7 (more details), 1.47 Å
SCOPe Domain Sequences for d6lh7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lh7a_ d.127.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} sikiknaveiekmrvagrlaaevlemiephvkagvtteeldqichkyitevqgaipapln yhgfpksictsinhivchgipasedtyfgqiqrpavlrdgdilniditvikdgyhgdtsk mfligdvsiedkrlchvaqeclylalkqvkpgvqlgeigttiekhiktnnknnprfkfsi vrdycghgigaefheepqvvhyknsdrtvlregmiftiepminagkfgcrlddedswtvy tadgkksaqwehtilvtatgceiltlrseeslprilnna
Timeline for d6lh7a_: