Lineage for d6ld7b_ (6ld7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898204Species Xanthomonas oryzae [TaxId:291331] [189393] (10 PDB entries)
  8. 2898218Domain d6ld7b_: 6ld7 B: [395149]
    automated match to d1cs1a_
    complexed with llp, peg, pge

Details for d6ld7b_

PDB Entry: 6ld7 (more details), 2.1 Å

PDB Description: native structure of cystathionine gamma synthase (xometb) from xanthomonas oryzae pv. oryzae
PDB Compounds: (B:) cystathionine gamma-synthase

SCOPe Domain Sequences for d6ld7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ld7b_ c.67.1.0 (B:) automated matches {Xanthomonas oryzae [TaxId: 291331]}
pctaataavragidrdtaygavtppivlssnfsfdgfgnkrqydytrsgnptrdllgeal
aeleggaggvitstgmgainlvlnavlqpgdtlvvphdayggswrlfnalakkghfalit
adltvprsladalaqspklvlietpsnpllritdlrfvieaakkvgaltvvdntflspal
qkpldfgadlvlhsttkyinghsdvvggavvardaelhqqlvwwanalgltgspfdaflt
lrglrtldarlrvhqenadaiaelldghamvnqvyfpglathpghalaarqqkgfgamms
feleggeaavrafvdglryftlaeslggvesliahpasmthaamtaearaaagisdgllr
lsigiesaedllidlraglsraeatl

SCOPe Domain Coordinates for d6ld7b_:

Click to download the PDB-style file with coordinates for d6ld7b_.
(The format of our PDB-style files is described here.)

Timeline for d6ld7b_: