Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins) PfamB PB001946 |
Protein automated matches [384919] (1 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384920] (27 PDB entries) |
Domain d7kegb2: 7keg B:191-346 [394960] Other proteins in same PDB: d7kega1, d7kega3, d7kegb1, d7kegb3 automated match to d2h85a2 complexed with po4 |
PDB Entry: 7keg (more details), 2.9 Å
SCOPe Domain Sequences for d7kegb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kegb2 d.294.1.2 (B:191-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsvvskvvkvtidyteisfmlwckdghvetfypklq
Timeline for d7kegb2: