Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (67 PDB entries) |
Domain d7k60f_: 7k60 F: [394913] Other proteins in same PDB: d7k60c_, d7k60d_, d7k60g_, d7k60h_, d7k60m1, d7k60m2, d7k60n1, d7k60n2 automated match to d1kx5b_ protein/DNA complex |
PDB Entry: 7k60 (more details), 3.12 Å
SCOPe Domain Sequences for d7k60f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k60f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk tvtamdvvyalkrqgrtlygfgg
Timeline for d7k60f_: