SCOPe 2.07: Domain d7k60m1: 7k60 M:19-126

Lineage for d7k60m1 (7k60 M:19-126)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d7k60m1: 7k60 M:19-126 [394871]
Other proteins in same PDB: d7k60b_, d7k60c_, d7k60d_, d7k60f_, d7k60g_, d7k60h_
automated match to d4f9lc1
protein/DNA complex

Details for d7k60m1

PDB Entry: 7k60 (more details), 3.12 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.10

PDB Compounds: (M:) scFv20

SCOPe Domain Sequences for d7k60m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k60m1 b.1.1.0 (M:19-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdikmtqspssmhaslgervtitckasqdirsylswyqqkpwkspktliyyatsladgvp
srfsgsgsgqdfsltinnlesddtatyyclqhgespytfgsgtkleik

SCOPe Domain Coordinates for d7k60m1:

Click to download the PDB-style file with coordinates for d7k60m1.
(The format of our PDB-style files is described here.)

Timeline for d7k60m1: