Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d7k60m1: 7k60 M:19-126 [394871] Other proteins in same PDB: d7k60b_, d7k60c_, d7k60d_, d7k60f_, d7k60g_, d7k60h_ automated match to d4f9lc1 protein/DNA complex |
PDB Entry: 7k60 (more details), 3.12 Å
SCOPe Domain Sequences for d7k60m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k60m1 b.1.1.0 (M:19-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mdikmtqspssmhaslgervtitckasqdirsylswyqqkpwkspktliyyatsladgvp srfsgsgsgqdfsltinnlesddtatyyclqhgespytfgsgtkleik
Timeline for d7k60m1: