Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165 |
Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) automatically mapped to Pfam PF06399 |
Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins) |
Protein automated matches [394245] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [394246] (3 PDB entries) |
Domain d7accd_: 7acc D: [394435] Other proteins in same PDB: d7accc2, d7acce2, d7accg2, d7acch2 automated match to d1wplk_ complexed with k |
PDB Entry: 7acc (more details), 2.04 Å
SCOPe Domain Sequences for d7accd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7accd_ d.205.1.1 (D:) automated matches {Homo sapiens [TaxId: 9606]} pyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkle rrgfrvlsmtgvgqtlvwclhke
Timeline for d7accd_: